SnapGeneViewer

SnapGeneViewer:ThefreeSnapGeneViewerisgreatforlookingatplasmidmapsandviewingsequencingtraces,whilethepaidversionprovides ...,SnapGeneViewerissoftwarethatallowsmolecularbiologiststocreate,browse,andsharerichlyannotatedDNAsequencefilesupto1GBinlength.Features ...,SnapGeneReaderisaPythonlibrarytoparseSnapgene*.dnafilesintodictionariesorBiopythonSeqRecords:,SnapGeneViewerisaprogramspecificallydesi...

Free Online Molecular Biology Tools

SnapGene Viewer: The free SnapGene Viewer is great for looking at plasmid maps and viewing sequencing traces, while the paid version provides ...

SnapGene Viewer for Windows

SnapGene Viewer is software that allows molecular biologists to create, browse, and share richly annotated DNA sequence files up to 1 GB in length. Features ...

snapgene

SnapGene Reader is a Python library to parse Snapgene *.dna files into dictionaries or Biopython SeqRecords:

SnapGene Viewer 4.1 Download (Free)

SnapGene Viewer is a program specifically designed for molecular biologists to help them create, annotate, and print DNA sequence files.

軟體代理經銷商

Share data with SnapGene Viewer; Run batch operations. Search. Search for DNA or protein sequences; Search for enzymes, features or primers. General. Cross ...

SnapGene Viewer

With SnapGene Viewer you can view plasmid maps, annotate features, and share sequences with your colleagues for free. And when you want to do more, subscribe to ...

Introduction to SnapGene

The main SnapGene interface has a Top menu from which you can access all SnapGene's functionality. ... SnapGene Viewer · How to Convert File Formats · Release ...

Downloads

SnapGene Features · SnapGene Viewer · How to Convert File Formats · Release Notes. Get SnapGene. Free Trial · Pricing · Course Licenses · iGEM. Resources.

Get Started

Learning how to use SnapGene is easy! We developed a few short videos to get you started ... SnapGene Viewer · How to Convert File Formats · Release Notes. Get ...

SnapGene

SnapGene offers the fastest and easiest way to plan, visualize, and document DNA cloning and PCR. You can easily annotate features and design primers.